International audienceThe amphibian family Leptodactylidae is divided into three sub-families: Leiuperinae, Leptodactylinae, and Paratelmatobiinae. Host-defense peptides (HDPs) present in the skins of frogs belonging to the Leptodactylinae have been studied extensively, but information is limited regarding peptides from Leiuperinae species. Peptidomic analysis of norepinephrine-stimulated skin secretions from the Tungara frog Engystomops pustulosus (Leiuperinae) collected in Trinidad led to the isolation and structural characterization of previously undescribed pustulosin-1 (FWKADVKEIG KKLAAKLAEELAKKLGEQ), [Q28E] pustulosin-1 (pustulosin-2), and pustulosin-3 (DWKETAKELLKKIGAKVAQVISDKLNPAPQ). The primary structures of these peptides do not r...
Eight new peptides were isolated from the skin secretion of the frog Leptodactylus pustulatus and th...
Frogs belong to the amphibian Order, Anura, and are distributed around the wor1d from the tropics to...
International audienceThe members of the Aquarana (or Rana catesbeiana species group) form a monophy...
Abstract The amphibian family Leptodactylidae is divided into three sub-families: Leiuperinae, Lepto...
International audienceFrogs from the extensive amphibian family Hylidae are a rich source of peptide...
Eight new peptides were isolated from the skin secretion of the frog Leptodactylus pustulatus and th...
International audiencePeptidomic analysis of norepinephrine-stimulated skin secretions from the Cari...
International audiencePeptide-based defenses of ranid frogs from Mexico and Central America have bee...
The dorsal skin of the crawfish frog, Rana areolata, is associated with numerous prominent granular ...
International audienceOcellatins are peptides produced in the skins of frogs belonging to the genus ...
International audienceThe members of the Aquarana (or Rana catesbeiana species group) form a well-su...
International audiencePeptidomic analysis of norepinephrine-stimulated skin secretions from Hose's r...
Amphibians´ skin produces a diverse array of antimicrobial peptides that play a crucial role as...
International audienceA glycine-leucine-rich peptide was isolated from norepinephrine-stimulated ski...
International audienceThe phylogenetic relationship between the relict leopard frog Lithobates (Rana...
Eight new peptides were isolated from the skin secretion of the frog Leptodactylus pustulatus and th...
Frogs belong to the amphibian Order, Anura, and are distributed around the wor1d from the tropics to...
International audienceThe members of the Aquarana (or Rana catesbeiana species group) form a monophy...
Abstract The amphibian family Leptodactylidae is divided into three sub-families: Leiuperinae, Lepto...
International audienceFrogs from the extensive amphibian family Hylidae are a rich source of peptide...
Eight new peptides were isolated from the skin secretion of the frog Leptodactylus pustulatus and th...
International audiencePeptidomic analysis of norepinephrine-stimulated skin secretions from the Cari...
International audiencePeptide-based defenses of ranid frogs from Mexico and Central America have bee...
The dorsal skin of the crawfish frog, Rana areolata, is associated with numerous prominent granular ...
International audienceOcellatins are peptides produced in the skins of frogs belonging to the genus ...
International audienceThe members of the Aquarana (or Rana catesbeiana species group) form a well-su...
International audiencePeptidomic analysis of norepinephrine-stimulated skin secretions from Hose's r...
Amphibians´ skin produces a diverse array of antimicrobial peptides that play a crucial role as...
International audienceA glycine-leucine-rich peptide was isolated from norepinephrine-stimulated ski...
International audienceThe phylogenetic relationship between the relict leopard frog Lithobates (Rana...
Eight new peptides were isolated from the skin secretion of the frog Leptodactylus pustulatus and th...
Frogs belong to the amphibian Order, Anura, and are distributed around the wor1d from the tropics to...
International audienceThe members of the Aquarana (or Rana catesbeiana species group) form a monophy...