Novel mesostructured silica microparticles are synthesized, characterized, and investigated as a drug delivery system (DDS) for antimicrobial applications. The materials exhibit a relatively high density (0.56 g per 1 g SiO2) of benzalkonium chloride (BAC), pore channels of 18 Å in width, and a high surface area (1500 m2/g). Comparison of the small-angle X-ray diffraction (SAXRD) pattern with Barrett–Joyner–Halenda (BJH) pore size distribution data suggests that the 18 Å pores exhibit short-range ordering and a wall thickness of ca. 12 Å. Drug release studies demonstrate pH-responsive controlled release of BAC without additional surface modification of the materials. Prolonged drug release data were analyzed using a power law (Korsmeyer–Pep...
Incorporation of the antimicrobial peptide LL-37 ([LL-37, 37 aa]), as well as...
Quaternary ammonium compounds (QACs) are a group of compounds of great economic significance. They a...
Bacterial infections are the main cause of chronic infections and even mortality. In fact, due to ex...
Mesoporous silica nanoparticles (MSNs) have captured the interest of researchers worldwide due to th...
Over the past several decades, mesoporous silica nanoparticles (MSNs) have attracted a tremendous de...
International audienceAims: In this study, benzalkonium chloride (BAC) microcapsules were developed ...
Benzalkonium chloride (BAC) is a common ingredient of disinfectants used for industrial, medical, fo...
A high number of studies support the use of mesoporous silica nanoparticles (MSN) as carriers for dr...
Doctor of PhilosophyDepartment of ChemistryStefan BossmannAmong the most threatening diseases in the...
Three porous matrices based on poly(lactic acid) are proposed herein for the controlled release of a...
Abstract Antimicrobial drug release from biomaterials for orthopedic repair and dental restorations ...
Due to the increasing incidents of antimicrobial-resistant pathogens, the development of new antibio...
The abuse of antibiotics has led to the emergence of antibiotic resistant bacteria and high threats ...
The mesoporous SBA-15 silica with uniform hexagonal pore, narrow pore size distribution and tuneable...
The release of the hydrophobic cancer drug dasatinib from two mesoporous silica materials as drug de...
Incorporation of the antimicrobial peptide LL-37 ([LL-37, 37 aa]), as well as...
Quaternary ammonium compounds (QACs) are a group of compounds of great economic significance. They a...
Bacterial infections are the main cause of chronic infections and even mortality. In fact, due to ex...
Mesoporous silica nanoparticles (MSNs) have captured the interest of researchers worldwide due to th...
Over the past several decades, mesoporous silica nanoparticles (MSNs) have attracted a tremendous de...
International audienceAims: In this study, benzalkonium chloride (BAC) microcapsules were developed ...
Benzalkonium chloride (BAC) is a common ingredient of disinfectants used for industrial, medical, fo...
A high number of studies support the use of mesoporous silica nanoparticles (MSN) as carriers for dr...
Doctor of PhilosophyDepartment of ChemistryStefan BossmannAmong the most threatening diseases in the...
Three porous matrices based on poly(lactic acid) are proposed herein for the controlled release of a...
Abstract Antimicrobial drug release from biomaterials for orthopedic repair and dental restorations ...
Due to the increasing incidents of antimicrobial-resistant pathogens, the development of new antibio...
The abuse of antibiotics has led to the emergence of antibiotic resistant bacteria and high threats ...
The mesoporous SBA-15 silica with uniform hexagonal pore, narrow pore size distribution and tuneable...
The release of the hydrophobic cancer drug dasatinib from two mesoporous silica materials as drug de...
Incorporation of the antimicrobial peptide LL-37 ([LL-37, 37 aa]), as well as...
Quaternary ammonium compounds (QACs) are a group of compounds of great economic significance. They a...
Bacterial infections are the main cause of chronic infections and even mortality. In fact, due to ex...