<p>Tammar cathelicidin peptides. WAM1 (a) – KRGFGKKLRKRLKKFRNSIKKRLKNFNVVIPIPLPG from MaeuCath1 (Genbank EF624481.1), WAM2 (b) -KRGLWESLKRKATKLGDDIRNTLRNFKIKFPVPRQG from MaeuCath5 (Genbank EF624484.1), Ancestral WAM (*)- RRGFWKRLRRRLRRFGDRIRNRFRNFREKLPDPFPG. Platypus cathelicidin peptides PAM1 (c) – RTKRRIKLIKNGVKKVKDILKNNNIIILPGSNEK from OranCath1 <a href="http://www.plosone.org/article/info:doi/10.1371/journal.pone.0024030#pone.0024030-Warren1" target="_blank">[23]</a> and PAM2 (d) – RPWAGNGSVHRYTVLSPRLKTQ from OranCath2 <a href="http://www.plosone.org/article/info:doi/10.1371/journal.pone.0024030#pone.0024030-Warren1" target="_blank">[23]</a>.</p
Antimicrobial peptides, such as cathelicidin, are an evolutionarily old defense system. However they...
The rise in antimicrobial resistance and paucity of new antimicrobial compounds calls for alternativ...
<p>Four antimicrobial peptide cDNA gene families of <i>A. cerana</i> and <i>A. mellifera</i> selecte...
Background: To overcome the increasing resistance of pathogens to existing antibiotics the 106’20 In...
BACKGROUND: To overcome the increasing resistance of pathogens to existing antibiotics the 10×'20 In...
Background: To overcome the increasing resistance of pathogens to existing antibiotics the 10× 20 In...
BACKGROUND: To overcome the increasing resistance of pathogens to existing antibiotics the 10×'20 In...
Trabajo presentado en la IV International Conference on Antimicrobial Research ICAR, celebrada en To...
Cathelicidin genes homologous to the human CAMP gene, coding for the host defense peptide LL-37, hav...
Cathelicidins are a ubiquitous family of host defence peptides (HDPs) in vertebrate animals. Unlike ...
Trabajo presentado en la IV International Conference on Antimicrobial Research ICAR, celebrada en To...
Cathelicidin genes homologous to the human CAMP gene, coding for the host defense peptide LL-37, hav...
The immune systems of all vertebrates contain cathelicidins, a family of antimicrobial peptides. Cat...
Trabajo presentado en el 1st Molecules Medicinal Chemistry Symposium, celebrado en Barcelona (España...
19 Pág. Centro de Biotecnología y Genómica de Plantas (CBGP)The immune systems of all vertebrates c...
Antimicrobial peptides, such as cathelicidin, are an evolutionarily old defense system. However they...
The rise in antimicrobial resistance and paucity of new antimicrobial compounds calls for alternativ...
<p>Four antimicrobial peptide cDNA gene families of <i>A. cerana</i> and <i>A. mellifera</i> selecte...
Background: To overcome the increasing resistance of pathogens to existing antibiotics the 106’20 In...
BACKGROUND: To overcome the increasing resistance of pathogens to existing antibiotics the 10×'20 In...
Background: To overcome the increasing resistance of pathogens to existing antibiotics the 10× 20 In...
BACKGROUND: To overcome the increasing resistance of pathogens to existing antibiotics the 10×'20 In...
Trabajo presentado en la IV International Conference on Antimicrobial Research ICAR, celebrada en To...
Cathelicidin genes homologous to the human CAMP gene, coding for the host defense peptide LL-37, hav...
Cathelicidins are a ubiquitous family of host defence peptides (HDPs) in vertebrate animals. Unlike ...
Trabajo presentado en la IV International Conference on Antimicrobial Research ICAR, celebrada en To...
Cathelicidin genes homologous to the human CAMP gene, coding for the host defense peptide LL-37, hav...
The immune systems of all vertebrates contain cathelicidins, a family of antimicrobial peptides. Cat...
Trabajo presentado en el 1st Molecules Medicinal Chemistry Symposium, celebrado en Barcelona (España...
19 Pág. Centro de Biotecnología y Genómica de Plantas (CBGP)The immune systems of all vertebrates c...
Antimicrobial peptides, such as cathelicidin, are an evolutionarily old defense system. However they...
The rise in antimicrobial resistance and paucity of new antimicrobial compounds calls for alternativ...
<p>Four antimicrobial peptide cDNA gene families of <i>A. cerana</i> and <i>A. mellifera</i> selecte...